Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OR8B8 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310237100UL
Description
OR8B8 Polyclonal specifically detects OR8B8 in Mouse samples. It is validated for Western Blot.Specifications
OR8B8 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
olfactory receptor 8B8, olfactory receptor OR11-316, Olfactory receptor TPCR85, olfactory receptor, family 8, subfamily B, member 8, Olfactory-like receptor JCG8, TPCR85 | |
The immunogen is a synthetic peptide directed towards the C terminal region of mouse OR8B8 (NP_666425.1). Peptide sequence PSSLLPMNQGKVSSLFYTIVVPMLNPLIYSLRNKDVKVALRKTLSRSSFS | |
100 μg | |
Primary | |
Mouse | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
26493 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction