Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OR8D2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | OR8D2 |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NB124547
|
Novus Biologicals
NBP309823100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
OR8D2 Polyclonal specifically detects OR8D2 in Human samples. It is validated for Western Blot.Specifications
OR8D2 | |
Western Blot | |
Unconjugated | |
Rabbit | |
Human | |
JCG2, olfactory receptor 8D2, Olfactory receptor OR11-303, olfactory receptor, family 8, subfamily D, member 2, Olfactory receptor-like protein JCG2 | |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR8D2 (NP_001002918). Peptide sequence PPSSTTMEKEKVSSVFYITIIPMLNPLIYSLRNKDVKNALKKMTRGRQSS | |
Affinity purified |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
PBS buffer, 2% sucrose | |
283160 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title