Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ORP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89


Antigen ORP1
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
View Documents
Novus Biologicals
100 μg
Each for $352.89
Add to cart
View Documents
Novus Biologicals
25 μg
Each for $106.19
Add to cart


ORP1 Polyclonal antibody specifically detects ORP1 in Human samples. It is validated for Western Blot


Western Blot
FLJ10217, ORP1oxysterol-binding protein-related protein 1, ORP-1oxysterol-binding protein-related protein 1 variant 1, OSBP8, OSBPL1, OSBPL1B, OSBP-related protein 1, oxysterol binding protein-like 1A, oxysterol binding protein-like 1B, oxysterol-binding protein-related protein 1 variant 2
The immunogen is a synthetic peptide directed towards the middle region of human ORP1 (NP_001229437.1). Peptide sequence LYGKWTECLYSVDPATFDAYKKNDKKNTEEKKNSKQMSTSEELDEMPVPD
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml
Lipid and Metabolism
PBS buffer, 2% sucrose
Affinity purified
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit