Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OSBP2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | OSBP2 |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NB126003
|
Novus Biologicals
NBP310551100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
OSBP2 Polyclonal specifically detects OSBP2 in Human samples. It is validated for Western Blot.Specifications
OSBP2 | |
Western Blot | |
Unconjugated | |
Rabbit | |
Lipid and Metabolism | |
PBS buffer, 2% sucrose | |
23762 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
Human | |
ORP4ORP-4KIAA1664Oxysterol-binding protein-related protein 4, OSBPL1, OSBPL4, OSBP-related protein 4, oxysterol binding protein 2, oxysterol binding protein-like 1, oxysterol binding protein-related protein 4, oxysterol-binding protein 2 | |
The immunogen is a synthetic peptide directed towards the N-terminal region of human OSBP2 (NP_001269667.1). Peptide sequence YEQEQRVHLEETIEQLAKQHNSLERAFHSAPGRPANPSKSFIEGSLLTPK | |
Affinity purified |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title