Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OSBPL9 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | OSBPL9 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP155152
|
Novus Biologicals
NBP155152 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
OSBPL9 Polyclonal specifically detects OSBPL9 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| OSBPL9 | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| Q8TAS8 | |
| 114883 | |
| Synthetic peptides corresponding to OSBPL9(oxysterol binding protein-like 9) The peptide sequence was selected from the N terminal of OSBPL9. Peptide sequence HQTPTPNSTGSGHSPPSSSLTSPSHVNLSPNTVPEFSYSSSEDEFYDADE. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| FLJ12492, FLJ14629, FLJ14801, FLJ32055, FLJ34384, ORP-9, ORP9MGC15035, OSBP4, OSBP-related protein 9, oxysterol binding protein-like 9, oxysterol-binding protein-related protein 9 | |
| OSBPL9 | |
| IgG | |
| Affinity Purified | |
| 61 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title