Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OTOS Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | OTOS |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP1570320
|
Novus Biologicals
NBP15703120UL |
20 μL |
Each for $152.22
|
|
NBP157031
|
Novus Biologicals
NBP157031 |
100 μL |
Each for $436.00
|
|
Description
OTOS Polyclonal specifically detects OTOS in Human samples. It is validated for Western Blot.Specifications
OTOS | |
Polyclonal | |
Rabbit | |
Q8NHW6 | |
150677 | |
Synthetic peptides corresponding to OTOS (otospiralin) The peptide sequence was selected from the N terminal of OTOS. Peptide sequence MQACMVPGLALCLLLGPLAGAKPVQEEGDPYAELPAMPYWPFSTSDFWNY. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
OTOSP, otospiralin | |
OTOS | |
IgG | |
Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title