Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

OTUD6A Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP19149820UL

 View more versions of this product

Catalog No. NBP19149820


Add to cart

Description

Description

OTUD6A Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

OTUD6A
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
OTUD6A
Synthetic peptide directed towards the middle region of human OTUD6A. Peptide sequence KMNLENRPPRSSKAHRKRERMESEERERQESIFQAEMSEHLAGFKREEEE.
32 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Western Blot
Western Blot 1:1000
NP_997203
DUBA2, DUBA-2, OTU domain containing 6A
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
139562
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit