p33MONOX Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156955

Catalog No. NBP156955

Description

p33MONOX Polyclonal specifically detects p33MONOX in Human samples. It is validated for Western Blot.

Specifications

• Antigen: p33MONOX
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Brain-derived rescue factor p60MONOX, FLJ21022, hypothetical protein LOC57179, KIAA1191, p60MONOX
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 57179
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96A73
• Gene Symbols: KIAA1191
• Immunogen: Synthetic peptides corresponding to KIAA1191(KIAA1191) The peptide sequence was selected from the middle region of KIAA1191. Peptide sequence TKYLRVAEALHKLKLQSGEVTKEERQPASAQSTPSTTPHSSPKQRPRGWF.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Guinea pig: 78%; Rabbit: 78%.
• Target Species: Human, Rat, Guinea Pig, Rabbit
• Isotype: IgG