Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
p38 delta/SAPK4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | p38 delta/SAPK4 |
|---|---|
| Applications | Western Blot, Immunohistochemistry |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15825620
|
Novus Biologicals
NBP15825620UL |
20 μL |
Each for $152.22
|
|
NBP158256
|
Novus Biologicals
NBP158256 |
100 μL |
Each for $436.00
|
|
Description
p38 delta/SAPK4 Polyclonal specifically detects p38 delta/SAPK4 in Human samples. It is validated for Western Blot, Immunohistochemistry.Specifications
| p38 delta/SAPK4 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication, Core ESC Like Genes, Stem Cell Markers | |
| O15264 | |
| 5603 | |
| Synthetic peptides corresponding to MAPK13(mitogen-activated protein kinase 13) The peptide sequence was selected from the middle region of MAPK13. Peptide sequence KMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVD. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| EC 2.7.11, EC 2.7.11.24, MAP kinase 13, MAPK 13, MGC99536, mitogen-activated protein kinase 13, Mitogen-activated protein kinase p38 delta, p38delta, PRKM13, SAPK4MAP kinase p38 delta, Stress-activated protein kinase 4 | |
| MAPK13 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title