Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

p38 delta/SAPK4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen p38 delta/SAPK4
Applications Western Blot, Immunohistochemistry
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15825620
View Documents
Novus Biologicals
NBP15825620UL
20 μL
Each for $152.22
Add to cart
 
NBP158256
View Documents
Novus Biologicals
NBP158256
100 μL
Each for $436.00
Add to cart
 
Description

Description

p38 delta/SAPK4 Polyclonal specifically detects p38 delta/SAPK4 in Human samples. It is validated for Western Blot, Immunohistochemistry.
Specifications

Specifications

p38 delta/SAPK4
Polyclonal
Rabbit
Cell Cycle and Replication, Core ESC Like Genes, Stem Cell Markers
O15264
5603
Synthetic peptides corresponding to MAPK13(mitogen-activated protein kinase 13) The peptide sequence was selected from the middle region of MAPK13. Peptide sequence KMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVD.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot, Immunohistochemistry
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
EC 2.7.11, EC 2.7.11.24, MAP kinase 13, MAPK 13, MGC99536, mitogen-activated protein kinase 13, Mitogen-activated protein kinase p38 delta, p38delta, PRKM13, SAPK4MAP kinase p38 delta, Stress-activated protein kinase 4
MAPK13
IgG
Affinity Purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit