Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

p38 gamma/SAPK3 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP19147920UL

 View more versions of this product

Catalog No. NBP19147920

Add to cart



p38 gamma/SAPK3 Polyclonal antibody specifically detects Antigen in Mouse samples. It is validated for Western Blotting.


p38 gamma/SAPK3
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
Synthetic peptide directed towards the C terminal of human Mapk12. Peptide sequence ERMLVLDAEQRVTAAEALTHPYFESLRDTEDEPKAQKYDDSFDDVDRTLE.
40 kDa
Cell Cycle and Replication
Western Blot
Western Blot 1:1000
EC 2.7.11, ERK3, ERK-6, ERK6MAPK 12, Extracellular signal-regulated kinase 6, MAP kinase 12, MAP kinase p38 gamma, mitogen-activated protein kinase 12, mitogen-activated protein kinase 3, Mitogen-activated protein kinase p38 gamma, P38GAMMA, PRKM12, SAPK-3, SAPK3EC, Stress-activated protein kinase 3
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit