Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
p40 (p63 delta) Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Applications | Western Blot |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP157004
|
Novus Biologicals
NBP157004 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
p40 Polyclonal specifically detects p40 in Human samples. It is validated for Western Blot.Specifications
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q7Z6M1 | |
| RABEPK | |
| IgG | |
| Affinity Purified |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 10244 | |
| Synthetic peptides corresponding to RABEPK (Rab9 effector protein with kelch motifs) The peptide sequence was selected from the N terminal of RABEPK. Peptide sequence SCSYLPPVGNAKRGKVFIVGGANPNRSFSDVHTMDLGKHQWDLDTCKGLL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title