p53R2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP187368

Catalog No. NBP187368

Description

p53R2 Polyclonal specifically detects p53R2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: p53R2
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q7LG56
• Gene Symbols: RRM2B
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MGDPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRKSSRRFV
• Quantity: 0.1 mL
• Research Discipline: Apoptosis, Checkpoint signaling, DNA Double Strand Break Repair, DNA Repair, Hypoxia, Modulation of DNA Pools
• Gene ID (Entrez): 50484
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: EC 1.17.4.1, MGC102856, MGC42116, MTDPS8A, MTDPS8B, p53-inducible ribonucleotide reductase small subunit 2 homolog, p53-inducible ribonucleotide reductase small subunit 2-like protein, p53R2, P53R2DKFZp686M05248, PEOA5, ribonucleoside-diphosphate reductase subunit M2 B, ribonucleotide reductase M2 B (TP53 inducible), TP53-inducible ribonucleotide reductase M2 B
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only