Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PA28 Activator beta Subunit/PSME2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP257628
Description
PA28 Activator beta Subunit/PSME2 Polyclonal specifically detects PA28 Activator beta Subunit/PSME2 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
PA28 Activator beta Subunit/PSME2 | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
11S regulator complex beta subunit, 11S regulator complex subunit beta, Activator of multicatalytic protease subunit 2, MCP activator, 31-kD subunit, PA28b, PA28betacell migration-inducing protein 22, proteasome (prosome, macropain) activator subunit 2 (PA28 beta), Proteasome activator 28 subunit beta, proteasome activator 28-beta, proteasome activator complex subunit 2, proteasome activator hPA28 subunit beta, REGbeta, REG-beta | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
PSME2 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IPDPPPKDDEMETDKQEKKEVPKCGFLPGNEKVLSLLALVK | |
100 μL | |
Neuroscience, Ubiquitin Proteasome Pathway | |
5721 | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?
Provide Content Correction