PAD3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP192240

Catalog No. NBP192240

Description

PAD3 Polyclonal specifically detects PAD3 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: PAD3
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: Q9ULW8
• Gene Symbols: PADI3
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:FRMLLASPGACFKLFQEKQKCGHGRALLFQGVVDDEQVKTISINQVLSNKDLINYNKFVQSCIDWNREV
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 51702
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: EC 3.5.3.15, MGC126307, PAD3, PDI3MGC126308, peptidyl arginine deiminase, type III, Peptidylarginine deiminase III, Protein-arginine deiminase type III, protein-arginine deiminase type-3
• Host Species: Rabbit
• Molecular Weight of Antigen: 75 kDa
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only