Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PAIP2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | PAIP2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179620
|
Novus Biologicals
NBP179620 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
PAIP2 Polyclonal specifically detects PAIP2 in Human samples. It is validated for Western Blot.Specifications
| PAIP2 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| MGC72018, PABC1-interacting protein 2, PABP-interacting protein 2, PAIP-2, PAIP2APoly(A)-binding protein-interacting protein 2, poly(A) binding protein interacting protein 2, polyA-binding protein-interacting protein 2, polyadenylate-binding protein-interacting protein 2 | |
| PAIP2 | |
| IgG | |
| Affinity Purified | |
| 14 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_057564 | |
| 51247 | |
| The immunogen for this antibody is PAIP2. Peptide sequence MKDPSRSSTSPSIINEDVIINGHSHEDDNPFAEYMWMENEEEFNRQIEEE. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title