Invitrogen™ PAK7 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA595311

Catalog No. PIPA595311

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human SH-SY5Y whole cell, rat brain tissue, mouse brain tissue. IHC: human glioma tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

PAK7 (KIAA1264) is implicated in the regulation of cytoskeletal dynamics, proliferation, and cell survival signaling. This kinase contains a CDC42/Rac1 interactive binding motif, and has been shown to bind CDC42 in the presence of GTP. This kinase is predominantly expressed in brain. It is capable of promoting neurite outgrowth, and thus may play a role in neurite development. This kinase is associated with microtubule networks and induces microtubule stabilization. The subcellular localization of this kinase is tightly regulated during cell cycle progression. Alternatively spliced transcript variants encoding the same protein have been described.

Specifications

• Antigen: PAK7
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: PAK5
• Gene Alias: 2900083L08Rik; 6430627N20; KIAA1264; p21 (CDKN1A)-activated kinase 7; p21 (RAC1) activated kinase 5; p21 (RAC1) activated kinase 7; p21 protein (Cdc42/Rac)-activated kinase 7; p21(CDKN1A)-activated kinase 7; p21-activated kinase 5; p21-activated kinase 7; p21CDKN1A-activated kinase 7; PAK 5; PAK 7; PAK5; PAK-5; Pak7; PAK-7; protein kinase PAK5; RP5-1119D9.3; Serine/threonine-protein kinase PAK 5; serine/threonine-protein kinase PAK 7; serine/threonine-protein kinase PAK7
• Host Species: Rabbit
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 241656, 311450, 57144
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: D4A280, Q8C015, Q9P286
• Gene Symbols: PAK5, Pak7
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human PAK5 (26-55aa DPQEQKFTGLPQQWHSLLADTANRPKPMVD).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov