Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PALS1/MPP5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Specifications

Antigen PALS1/MPP5
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP154724
View Documents
Novus Biologicals
NBP154724
100 μL
Each of 1 for $436.00
N/A
Description

Description

PALS1/MPP5 Polyclonal specifically detects PALS1/MPP5 in Human samples. It is validated for Western Blot.
Specifications

Specifications

PALS1/MPP5
Polyclonal
Rabbit
Q8N3R9
64398
Synthetic peptides corresponding to MPP5(membrane protein, palmitoylated 5 (MAGUK p55 subfamily member 5)) The peptide sequence was selected from the N terminal of MPP5 (NP_071919.2). AVDCPGDLGTRMMPIRRSAQLERIRQQQEDMRRRREEEGKKQELDLNSSM.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
MAGUK p55 subfamily member 5, membrane protein, palmitoylated 5 (MAGUK p55 subfamily member 5), PALS1FLJ12615, stardust
MPP5
IgG
Affinity Purified
77 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit