Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PALS1/MPP5 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Specifications
| Antigen | PALS1/MPP5 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP154724
|
Novus Biologicals
NBP154724 |
100 μL |
Each of 1 for $436.00
|
N/A | |||||
Description
PALS1/MPP5 Polyclonal specifically detects PALS1/MPP5 in Human samples. It is validated for Western Blot.Specifications
| PALS1/MPP5 | |
| Polyclonal | |
| Rabbit | |
| Q8N3R9 | |
| 64398 | |
| Synthetic peptides corresponding to MPP5(membrane protein, palmitoylated 5 (MAGUK p55 subfamily member 5)) The peptide sequence was selected from the N terminal of MPP5 (NP_071919.2). AVDCPGDLGTRMMPIRRSAQLERIRQQQEDMRRRREEEGKKQELDLNSSM. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| MAGUK p55 subfamily member 5, membrane protein, palmitoylated 5 (MAGUK p55 subfamily member 5), PALS1FLJ12615, stardust | |
| MPP5 | |
| IgG | |
| Affinity Purified | |
| 77 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title