PANK4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155012

Catalog No. NBP155012

Description

PANK4 Polyclonal specifically detects PANK4 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PANK4
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9NVE7
• Gene Symbols: PANK4
• Immunogen: Synthetic peptides corresponding to PANK4(pantothenate kinase 4) The peptide sequence was selected from the N terminal of PANK4. Peptide sequence MAECGASGSGSSGDSLDKSITLPPDEIFRNLENAKRFAIDIGGSLTKLAY.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Zebrafish: 82%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DKFZp547M242, EC 2.7.1.33, FLJ10782, hPanK4, pantothenate kinase 4, Pantothenic acid kinase 4
• Host Species: Rabbit
• Molecular Weight of Antigen: 86 kDa
• Quantity: 100 μL
• Research Discipline: Cellular Signaling
• Gene ID (Entrez): 55229
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.