Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PANK4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP155012
Description
PANK4 Polyclonal specifically detects PANK4 in Human samples. It is validated for Western Blot.Specifications
PANK4 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
DKFZp547M242, EC 2.7.1.33, FLJ10782, hPanK4, pantothenate kinase 4, Pantothenic acid kinase 4 | |
Rabbit | |
86 kDa | |
100 μL | |
Cellular Signaling | |
55229 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q9NVE7 | |
PANK4 | |
Synthetic peptides corresponding to PANK4(pantothenate kinase 4) The peptide sequence was selected from the N terminal of PANK4. Peptide sequence MAECGASGSGSSGDSLDKSITLPPDEIFRNLENAKRFAIDIGGSLTKLAY. | |
Affinity purified | |
RUO | |
Primary | |
Zebrafish: 82%. | |
Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Zebrafish | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction