Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PANK4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | PANK4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP155012
|
Novus Biologicals
NBP155012 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
PANK4 Polyclonal specifically detects PANK4 in Human samples. It is validated for Western Blot.Specifications
| PANK4 | |
| Polyclonal | |
| Rabbit | |
| Q9NVE7 | |
| 55229 | |
| Synthetic peptides corresponding to PANK4(pantothenate kinase 4) The peptide sequence was selected from the N terminal of PANK4. Peptide sequence MAECGASGSGSSGDSLDKSITLPPDEIFRNLENAKRFAIDIGGSLTKLAY. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DKFZp547M242, EC 2.7.1.33, FLJ10782, hPanK4, pantothenate kinase 4, Pantothenic acid kinase 4 | |
| PANK4 | |
| IgG | |
| 86 kDa |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title