Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PANK4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | PANK4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP155012
|
Novus Biologicals
NBP155012 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
PANK4 Polyclonal specifically detects PANK4 in Human samples. It is validated for Western Blot.Specifications
| PANK4 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| DKFZp547M242, EC 2.7.1.33, FLJ10782, hPanK4, pantothenate kinase 4, Pantothenic acid kinase 4 | |
| PANK4 | |
| IgG | |
| Affinity Purified | |
| 86 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9NVE7 | |
| 55229 | |
| Synthetic peptides corresponding to PANK4(pantothenate kinase 4) The peptide sequence was selected from the N terminal of PANK4. Peptide sequence MAECGASGSGSSGDSLDKSITLPPDEIFRNLENAKRFAIDIGGSLTKLAY. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title