Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PAOX Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | PAOX |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP170667
|
Novus Biologicals
NBP170667 |
100 μL |
Each for $436.00
|
|
NBP17066720
|
Novus Biologicals
NBP17066720UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
PAOX Polyclonal specifically detects PAOX in Human samples. It is validated for Western Blot.Specifications
| PAOX | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q6QHF9 | |
| 196743 | |
| Synthetic peptides corresponding to PAOX(polyamine oxidase (exo-N4-amino)) The peptide sequence was selected from the middle region of PAOX. Peptide sequence RGSAVGMEGGRPPPQSVGPAGAAAQAQALAGPSLLCSTRVGGRLGPSFLL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| DKFZp434J245, MGC45464, PAO, polyamine oxidase, polyamine oxidase (exo-N4-amino) | |
| PAOX | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title