PAPOLB Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157560

Catalog No. NBP157560

Description

PAPOLB Polyclonal specifically detects PAPOLB in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PAPOLB
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: A4D1Z6
• Gene Symbols: PAPOLB
• Immunogen: Synthetic peptides corresponding to PAPOLB(poly(A) polymerase beta (testis specific)) The peptide sequence was selected from the N terminal of PAPOLB. Peptide sequence TDCLLTQRLIETLRPFGVFEEEEELQRRILVLEKLNNLVKEWIREISESK.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Rabbit: 100%; Canine: 92%; Mouse: 92%; Rat: 92%; Zebrafish: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS & 2% Sucrose. with 0.09% Sodium Azide
• Gene Alias: EC 2.7.7, EC 2.7.7.19, PAP-beta, PAPTTPAP, poly(A) polymerase beta, poly(A) polymerase beta (testis specific), Polynucleotide adenylyltransferase beta, Testis-specific poly(A) polymerase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 56903
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.