Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PAQR6 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | PAQR6 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP159477
|
Novus Biologicals
NBP159477 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
PAQR6 Polyclonal specifically detects PAQR6 in Human samples. It is validated for Western Blot.Specifications
| PAQR6 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| progestin and adipoQ receptor family member 6, progestin and adipoQ receptor family member VIFLJ22672 | |
| PAQR6 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q5TCK9 | |
| 79957 | |
| Synthetic peptides corresponding to PAQR6(progestin and adipoQ receptor family member VI) The peptide sequence was selected from the N terminal of PAQR6. Peptide sequence PGLSKVLRTGAFAYPFLFDNLPLFYRLGLCWGRGHGCGQEALSTSHGYHL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title