PARC Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP258049

Catalog No. NBP258049

Description

PARC Polyclonal specifically detects PARC in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: PARC
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: CUL-9, cullin 9, cullin-9, DKFZp686G1042, H7AP1DKFZp686P2024, p53-associated parkin-like cytoplasmic protein, PARCKIAA0708, parkin-like cytoplasmic p53 binding protein, RP3-330M21.2, UbcH7-associated protein 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: CUL9
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:WKPNHKDYYNCSAMVSKAARQEKRFQDYNERCTFHHQAREFAVNLRNRVSAIHEVPPPRSFTFLNDACQGLEQARKVLAYACVYSFYSQDAEYMDVVEQQTENLELHT
• Quantity: 100 μL
• Research Discipline: Cancer, DNA Repair, Tumor Suppressors
• Gene ID (Entrez): 23113
• Target Species: Human
• Isotype: IgG

For Research Use Only