Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PARD3/Par3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310559100UL
Description
PARD3/Par3 Polyclonal specifically detects PARD3/Par3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| PARD3/Par3 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin | |
| FLJ21015, par-3 partitioning defective 3 homolog (C. elegans), PAR3A, PAR3C.elegans) homolog | |
| The immunogen is a synthetic peptide directed towards the N-terminal region of Human PARD3/Par3. Peptide sequence LEHGDGGILDLDDILCDVADDKDRLVAVFDEQDPHHGGDGTSASSTGTQS | |
| 100 μg | |
| Cell Cycle and Replication | |
| 56288 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction