Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PARD6B Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP31056025UL

 View more versions of this product

Catalog No. NB126022


Description

Description

PARD6B Polyclonal specifically detects PARD6B in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry.
Specifications

Specifications

PARD6B
Unconjugated
PBS buffer, 2% sucrose
par-6 (partitioning defective 6, C.elegans) homolog beta, PAR-6 beta, par-6 partitioning defective 6 homolog beta (C. elegans), PAR6B, PAR-6B, partitioning defective 6 homolog beta
The immunogen is a synthetic peptide directed towards the N-terminal region of MOUSE PARD6B (NP_067384). Peptide sequence SKFGAEFRRFSLERSKPGKFEEFYGLLQHVHKIPNVDVLVGYADIHGDLL
25 μg
Cell Cycle and Replication
Primary
84612
Western Blot, Immunohistochemistry
Western Blot 1.0 ug/ml, Immunohistochemistry
Purified
Rabbit
Affinity purified
RUO
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Polyclonal
Human, Mouse
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit