Parkin Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP180515

Catalog No. NBP180515

Description

Parkin Polyclonal specifically detects Parkin in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: Parkin
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_057903
• Gene Symbols: PRKN
• Immunogen: Synthetic peptide directed towards amino acids 311-360 of the mouse Park2. Peptide sequence YTRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEQGQRKVTCEGGNGLGCG.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS & 2% Sucrose. with 0.09% Sodium Azide
• Gene Alias: E3 ubiquitin ligase, E3 ubiquitin-protein ligase parkin, EC 6.3.2.-, LPRS2, parkin, parkin 2, Parkinson disease protein 2, Parkinson juvenile disease protein 2, parkinson protein 2, E3 ubiquitin protein ligase (parkin), PDJjuvenile) 2, parkin
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5071
• Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine
• Isotype: IgG