Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Parkin Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | Parkin |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP18051520
|
Novus Biologicals
NBP18051520UL |
20 μL |
Each for $152.22
|
|
NBP180515
|
Novus Biologicals
NBP180515 |
100 μL |
Each for $436.00
|
|
Description
Parkin Polyclonal specifically detects Parkin in Mouse samples. It is validated for Western Blot.Specifications
| Parkin | |
| Polyclonal | |
| Rabbit | |
| NP_057903 | |
| 5071 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| E3 ubiquitin ligase, E3 ubiquitin-protein ligase parkin, EC 6.3.2.-, LPRS2, parkin, parkin 2, Parkinson disease protein 2, Parkinson juvenile disease protein 2, parkinson protein 2, E3 ubiquitin protein ligase (parkin), PDJjuvenile) 2, parkin | |
| Synthetic peptide directed towards amino acids 311-360 of the mouse Park2. Peptide sequence YTRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEQGQRKVTCEGGNGLGCG. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title