Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PARN Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP180250
Description
PARN Polyclonal specifically detects PARN in Human, Mouse samples. It is validated for Western Blot.Specifications
PARN | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
DANEC 3.1.13.4, Deadenylating nuclease, Deadenylation nuclease, poly(A)-specific ribonuclease (deadenylation nuclease), poly(A)-specific ribonuclease PARN, Polyadenylate-specific ribonuclease | |
Rabbit | |
69 kDa | |
100 μL | |
Primary | |
Zebrafish: 83%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
Purified |
Western Blot | |
1 mg/ml | |
Western Blot 1.0 ug/ml | |
NP_083037 | |
PARN | |
Synthetic peptide directed towards the N terminal of human PARN. Peptide sequence IEEADFFAIDGEFSGISNGPSVTALTSGFDTPEERYQKLKKHSMDFLLFQ. | |
Protein A purified | |
RUO | |
5073 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction