Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PARP2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP154680

 View more versions of this product

Catalog No. NBP154680


Add to cart

Description

Description

PARP2 Polyclonal antibody specifically detects PARP2 in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence.
Specifications

Specifications

PARP2
Unconjugated
PBS & 2% Sucrose. with 0.09% Sodium Azide
Affinity Purified
PARP2
Synthetic peptides corresponding to PARP2 (poly (ADP-ribose) polymerase family, member 2) The peptide sequence was selected from the middle region of PARP2. Peptide sequence LLDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAHPEA.
61 kDa
100 ul
Apoptosis, DNA Repair, Hypoxia
Primary
10038
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat
Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Western Blot
Western Blot 1:100-1:2000, Immunohistochemistry, Immunocytochemistry/Immunofluorescence
Q9UGN5
ADP-ribosyltransferase (NAD+; poly(ADP-ribose) polymerase)-like 2, ADPRT-2, ADPRT2pADPRT-2, ADPRTL2EC 2.4.2.30, ADPRTL3, hPARP-2, NAD(+) ADP-ribosyltransferase 2, PARP-2, poly (ADP-ribose) polymerase 2, poly (ADP-ribose) polymerase family, member 2, poly (ADP-ribosyl) transferase-like 2, poly [ADP-ribose] polymerase 2, poly(ADP-ribose) synthetase, Poly[ADP-ribose] synthase 2, poly[ADP-ribose] synthetase 2
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit