Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Pax3 Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen Pax3
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry
Applications Western Blot, Immunohistochemistry
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB126809
View Documents
Novus Biologicals
NBP310955100UL
100 μg
Each for $352.89
Add to cart
 
NB126810
View Documents
Novus Biologicals
NBP31095525UL
25 μg
Each for $106.19
Add to cart
 
Description

Description

Pax3 Polyclonal antibody specifically detects Pax3 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry
Specifications

Specifications

Pax3
Western Blot, Immunohistochemistry
Purified
RUO
Human, Mouse
CDHS, HuP2, HUP2MGC120384, MGC120381, MGC120382, MGC120383, MGC134778, paired box 3, paired box gene 3 (Waardenburg syndrome 1), paired box homeotic gene 3, paired box protein Pax-3, paired domain gene 3, paired domain gene HuP2, Waardenburg syndrome 1, WS1, WS3
The immunogen is a synthetic peptide directed towards the C terminal region of human Pax3 (NP_852122). Peptide sequence GGVPHQPQTDYALSPLTGGLEPTTTVSASCSQRLDHMKSLDSLPTSQSYC
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml, Immunohistochemistry
Unconjugated
Rabbit
Apoptosis, Mesenchymal Stem Cell Markers, Stem Cell Markers, Transcription Factors and Regulators
PBS buffer, 2% sucrose
5077
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit