Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Pax3 Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | Pax3 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml, Immunohistochemistry |
| Applications | Western Blot, Immunohistochemistry |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NB126809
|
Novus Biologicals
NBP310955100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
Pax3 Polyclonal specifically detects Pax3 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry.Specifications
| Pax3 | |
| Western Blot, Immunohistochemistry | |
| Unconjugated | |
| Rabbit | |
| Apoptosis, Mesenchymal Stem Cell Markers, Stem Cell Markers, Transcription Factors and Regulators | |
| PBS buffer, 2% sucrose | |
| 5077 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml, Immunohistochemistry | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| CDHS, HuP2, HUP2MGC120384, MGC120381, MGC120382, MGC120383, MGC134778, paired box 3, paired box gene 3 (Waardenburg syndrome 1), paired box homeotic gene 3, paired box protein Pax-3, paired domain gene 3, paired domain gene HuP2, Waardenburg syndrome 1, WS1, WS3 | |
| The immunogen is a synthetic peptide directed towards the C terminal region of human Pax3 (NP_852122). Peptide sequence GGVPHQPQTDYALSPLTGGLEPTTTVSASCSQRLDHMKSLDSLPTSQSYC | |
| Affinity purified |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title