Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PBLD Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | PBLD |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NB125353
|
Novus Biologicals
NBP310226100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
PBLD Polyclonal specifically detects PBLD in Mouse samples. It is validated for Western Blot.Specifications
| PBLD | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Mouse | |
| EC 5.1, FLJ14767, FLJ35507, MAWBPMAWDBPMAWD binding protein, MAWD-binding protein, phenazine biosynthesis-like domain-containing protein, phenazine biosynthesis-like protein domain containing, Unknown protein 32 from 2D-page of liver tissue | |
| The immunogen is a synthetic peptide directed towards the middle region of mouse PBLD (NP_080977.2). Peptide sequence GLILTVKGEPGGQTAPYDFYSRYFAPWVGIAEDPVTGSAHTVLSSYWSQQ | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 64081 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title