Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PCBP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP180454
Description
PCBP1 Polyclonal specifically detects PCBP1 in Human, Mouse samples. It is validated for Western Blot.Specifications
PCBP1 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
alpha-CP1, Heterogeneous nuclear ribonucleoprotein E1, heterogenous nuclear ribonucleoprotein E1, heterogenous nuclear ribonucleoprotein X, hnRNP E1, hnRNP-E1, hnRNP-X, HNRPE1, HNRPX, nucleic acid binding protein sub 2.3, Nucleic acid-binding protein SUB2.3, poly(rC) binding protein 1, poly(rC)-binding protein 1 | |
Rabbit | |
Protein A purified | |
RUO | |
Primary | |
Expected identity based on immunogen sequence: Bovine: 92%; Equine: 92%; Human: 92%; Mouse: 92%; Rabbit: 92%; Rat: 92%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
Purified |
Western Blot | |
1 mg/ml | |
Western Blot 1.0 ug/ml | |
NP_006187 | |
PCBP1 | |
Synthetic peptide directed towards the middle region of human PCBP1. Peptide sequence CSDAVGYPHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAM. | |
100 μL | |
DNA replication Transcription Translation and Splicing | |
5093 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction