PCBP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP180454

Catalog No. NBP180454

Description

PCBP1 Polyclonal specifically detects PCBP1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PCBP1
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_006187
• Gene Symbols: PCBP1
• Immunogen: Synthetic peptide directed towards the middle region of human PCBP1. Peptide sequence CSDAVGYPHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAM.
• Quantity: 100 μL
• Research Discipline: DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 5093
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: alpha-CP1, Heterogeneous nuclear ribonucleoprotein E1, heterogenous nuclear ribonucleoprotein E1, heterogenous nuclear ribonucleoprotein X, hnRNP E1, hnRNP-E1, hnRNP-X, HNRPE1, HNRPX, nucleic acid binding protein sub 2.3, Nucleic acid-binding protein SUB2.3, poly(rC) binding protein 1, poly(rC)-binding protein 1
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 92%; Equine: 92%; Human: 92%; Mouse: 92%; Rabbit: 92%; Rat: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Form: Purified