Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PCBP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | PCBP1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP18045420
|
Novus Biologicals
NBP18045420UL |
20 μL |
Each for $152.22
|
|
NBP180454
|
Novus Biologicals
NBP180454 |
100 μL |
Each for $436.00
|
|
Description
PCBP1 Polyclonal specifically detects PCBP1 in Human samples. It is validated for Western Blot.Specifications
PCBP1 | |
Polyclonal | |
Purified | |
RUO | |
NP_006187 | |
5093 | |
Synthetic peptide directed towards the middle region of human PCBP1. Peptide sequence CSDAVGYPHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAM. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
alpha-CP1, Heterogeneous nuclear ribonucleoprotein E1, heterogenous nuclear ribonucleoprotein E1, heterogenous nuclear ribonucleoprotein X, hnRNP E1, hnRNP-E1, hnRNP-X, HNRPE1, HNRPX, nucleic acid binding protein sub 2.3, Nucleic acid-binding protein SUB2.3, poly(rC) binding protein 1, poly(rC)-binding protein 1 | |
PCBP1 | |
IgG | |
Protein A purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title