Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PCBP3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | PCBP3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15732520
|
Novus Biologicals
NBP15732520UL |
20 μL |
Each for $152.22
|
|
NBP157325
|
Novus Biologicals
NBP157325 |
100 μL |
Each for $436.00
|
|
Description
PCBP3 Polyclonal specifically detects PCBP3 in Human samples. It is validated for Western Blot.Specifications
| PCBP3 | |
| Polyclonal | |
| Rabbit | |
| P57721 | |
| 54039 | |
| Synthetic peptides corresponding to PCBP3(poly(rC) binding protein 3) The peptide sequence was selected from the middle region of PCBP3. Peptide sequence QTPFPPLGQTNPAFPGEKLPLHSSEEAQNLMGQSSGLDASPPASTHELTI. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Alpha-CP3, poly (rC)-binding protein 310ALPHA-CP3, poly(rC) binding protein 3, poly(rC)-binding protein 3 | |
| PCBP3 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title