Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PCDH11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit
Regulatory Status	RUO

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP179198 View Documents View Product Certificates	Novus Biologicals NBP179198	100 μL	Each of 1 for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

PCDH11 Polyclonal specifically detects PCDH11 in Mouse samples. It is validated for Western Blot.

Specifications

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene ID (Entrez)	27328
Isotype	IgG

Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	NP_001074854
Immunogen	The immunogen for this antibody is Pcdh11x. Peptide sequence LNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADS.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

PCDH11 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents