Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PCDH11X Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Applications | Western Blot |
---|---|
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Regulatory Status | RUO |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP179198
|
Novus Biologicals
NBP179198 |
100 μL |
Each of 1 for $436.00
|
|
Description
PCDH11 Polyclonal specifically detects PCDH11 in Mouse samples. It is validated for Western Blot.Specifications
Western Blot | |
Unconjugated | |
RUO | |
NP_001074854 | |
The immunogen for this antibody is Pcdh11x. Peptide sequence LNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADS. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
27328 | |
IgG | |
Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title