PCDHGB1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159240

Catalog No. NBP159240

Description

PCDHGB1 Polyclonal specifically detects PCDHGB1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PCDHGB1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: MGC119466, MGC119467, MGC119469, PCDH-GAMMA-B1, protocadherin gamma subfamily B, 1, protocadherin gamma-B1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 56104
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q3SY75
• Gene Symbols: PCDHGB1
• Immunogen: Synthetic peptides corresponding to PCDHGB1(protocadherin gamma subfamily B, 1) The peptide sequence was selected from the N terminal of PCDHGB1. Peptide sequence SPDGSKYPVLLLEKPLDREHQSSHRLILTAMDGGDPPLSGTTHIWIRVTD.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Rabbit: 100%; Mouse: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG