Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PCDHGB1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | PCDHGB1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15924020
|
Novus Biologicals
NBP15924020UL |
20 μL |
Each for $152.22
|
|
NBP159240
|
Novus Biologicals
NBP159240 |
100 μL |
Each for $436.00
|
|
Description
PCDHGB1 Polyclonal specifically detects PCDHGB1 in Human samples. It is validated for Western Blot.Specifications
PCDHGB1 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
MGC119466, MGC119467, MGC119469, PCDH-GAMMA-B1, protocadherin gamma subfamily B, 1, protocadherin gamma-B1 | |
PCDHGB1 | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
Q3SY75 | |
56104 | |
Synthetic peptides corresponding to PCDHGB1(protocadherin gamma subfamily B, 1) The peptide sequence was selected from the N terminal of PCDHGB1. Peptide sequence SPDGSKYPVLLLEKPLDREHQSSHRLILTAMDGGDPPLSGTTHIWIRVTD. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title