Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Our pricing system is unavailable. You are viewing list price.
Please call 1-800-766-7000 to place your order or try our site again later.

PCNA associated factor Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP18055520UL

 View more versions of this product

Catalog No. NBP18055520



Description

Description

PCNA associated factor Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

PCNA associated factor
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
KIAA0101
Synthetic peptide directed towards the N terminal of human KIAA0101. Peptide sequence MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKEHVLCNLI.
7 kDa
20ul
Cancer
Primary
9768
Immunohistochemistry (Paraffin), Western Blot
Western Blot 1:1000, Immunohistochemistry-Paraffin
NP_001025160
HCV NS5A-transactivated protein 9, Hepatitis C virus NS5A-transactivated protein 9, KIAA0101, NS5ATP9p15PAF, OEATC-1OEATC1, Overexpressed in anaplastic thyroid carcinoma 1, p15(PAF), PAF, PCNA-associated factor
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit