Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PCNP Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | PCNP |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP179669
|
Novus Biologicals
NBP179669 |
100 μL |
Each of 1 for $436.00
|
|
Description
PCNP Polyclonal specifically detects PCNP in Mouse samples. It is validated for Western Blot.Specifications
PCNP | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
DKFZp781I24156, PEST proteolytic signal containing nuclear protein, PEST proteolytic signal-containing nuclear protein, PEST-containing nuclear protein | |
PCNP | |
IgG | |
Affinity Purified | |
20 kDa |
Western Blot | |
Unconjugated | |
RUO | |
NP_001019793 | |
57092 | |
Synthetic peptide directed towards the C terminal of human PcnpThe immunogen for this antibody is Pcnp. Peptide sequence AFNEDEDSEPEEMPPEAKMRMKNIGRDTPTSAGPNSFNKGKHGFSDNQKL. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title