Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PCTP Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | PCTP |
|---|---|
| Dilution | Immunohistochemistry |
| Applications | Immunohistochemistry |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NB123757
|
Novus Biologicals
NBP309428100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
PCTP Polyclonal specifically detects PCTP in Human samples. It is validated for Immunohistochemistry.Specifications
| PCTP | |
| Immunohistochemistry | |
| Unconjugated | |
| Rabbit | |
| Human | |
| PC-TP, phosphatidylcholine transfer protein, StARD2, STARD2StAR-related lipid transfer (START) domain containing 2, StAR-related lipid transfer protein 2, START domain-containing protein 2 | |
| The immunogen is a synthetic peptide directed towards the following sequence VLEDCSPTLLADIYMDSDYRKQWDQYVKELYEQECNGETVVYWEVKYPFP (NP_067036). Peptide sequence VLEDCSPTLLADIYMDSDYRKQWDQYVKELYEQECNGETVVYWEVKYPFP | |
| Affinity purified |
| Immunohistochemistry | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 58488 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title