Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PDAP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP155238
Description
PDAP1 Polyclonal specifically detects PDAP1 in Human samples. It is validated for Western Blot.Specifications
PDAP1 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
Q13442 | |
PDAP1 | |
Synthetic peptides corresponding to PDAP1(PDGFA associated protein 1) The peptide sequence was selected from the N terminal of PDAP1. Peptide sequence MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGD. | |
Affinity Purified | |
RUO | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
HASPP28, PAP1PDGFA-associated protein 1, PAP28 kDa heat- and acid-stable phosphoprotein, PDGFA associated protein 1, PDGF-associated protein | |
Rabbit | |
20 kDa | |
100 μL | |
Signal Transduction | |
11333 | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title