Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PDAP1 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15523820UL

 View more versions of this product

Catalog No. NBP15523820


Add to Cart

Description

Description

PDAP1 Polyclonal specifically detects PDAP1 in Human samples. It is validated for Western Blot.
Specifications

Specifications

PDAP1
Polyclonal
Western Blot 1:100-1:2000
Q13442
PDAP1
Synthetic peptides corresponding to PDAP1(PDGFA associated protein 1) The peptide sequence was selected from the N terminal of PDAP1. Peptide sequence MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGD.
Affinity Purified
RUO
11333
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
HASPP28, PAP1PDGFA-associated protein 1, PAP28 kDa heat- and acid-stable phosphoprotein, PDGFA associated protein 1, PDGF-associated protein
Rabbit
20 kDa
20 μL
Primary
Human
IgG
Product Suggestions

Product Suggestions

SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit