Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PDAP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | PDAP1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15523820
|
Novus Biologicals
NBP15523820UL |
20 μL |
Each for $152.22
|
|
NBP155238
|
Novus Biologicals
NBP155238 |
100 μL |
Each for $436.00
|
|
Description
PDAP1 Polyclonal specifically detects PDAP1 in Human samples. It is validated for Western Blot.Specifications
| PDAP1 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| HASPP28, PAP1PDGFA-associated protein 1, PAP28 kDa heat- and acid-stable phosphoprotein, PDGFA associated protein 1, PDGF-associated protein | |
| PDAP1 | |
| IgG | |
| Affinity Purified | |
| 20 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q13442 | |
| 11333 | |
| Synthetic peptides corresponding to PDAP1(PDGFA associated protein 1) The peptide sequence was selected from the N terminal of PDAP1. Peptide sequence MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGD. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title