PDIA6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23821325UL

Catalog No. NB396932

Description

PDIA6 Polyclonal specifically detects PDIA6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

• Antigen: PDIA6
• Classification: Polyclonal
• Dilution: Western Blot 0.04 - 0.4 μg/mL, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500, Knockdown Validated
• Gene Accession No.: Q15084
• Gene Symbols: PDIA6
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: YGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELLEIINEDIAKRTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLA
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: EC 5.3.4.1, Endoplasmic reticulum protein 5, ERp5, ERP5ER protein 5, P5TXNDC7, protein disulfide isomerase family A, member 6, Protein disulfide isomerase P5, protein disulfide isomerase-associated 6, protein disulfide isomerase-related protein, protein disulfide-isomerase A6, thioredoxin domain containing 7 (protein disulfide isomerase), Thioredoxin domain-containing protein 7
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10130
• Target Species: Human
• Isotype: IgG