Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PDIK1L Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | PDIK1L |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156733
|
Novus Biologicals
NBP156733 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
PDIK1L Polyclonal specifically detects PDIK1L in Human samples. It is validated for Western Blot.Specifications
| PDIK1L | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| casein kinase, CLIK1LRP11-96L14.4, EC 2.7.11.1, PDLIM1 interacting kinase 1 like, PDLIM1-interacting kinase 1-like, serine/threonine-protein kinase PDIK1L, STK35L2 | |
| PDIK1L | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8N165 | |
| 149420 | |
| Synthetic peptides corresponding to PDIK1L(PDLIM1 interacting kinase 1 like) The peptide sequence was selected from the middle region of PDIK1L. Peptide sequence TSDLEPTLKVADFGLSKVCSASGQNPEEPVSVNKCFLSTACGTDFYMAPE. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title