Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PDLIM3 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155197

 View more versions of this product

Catalog No. NBP155197


Add to Cart

Description

Description

PDLIM3 Polyclonal specifically detects PDLIM3 in Human samples. It is validated for Western Blot.
Specifications

Specifications

PDLIM3
Polyclonal
Unconjugated
PBS, 2% Sucrose with 0.09% Sodium Azide
Actinin-associated LIM protein, ALPFLJ26096, Alpha-actinin-2-associated LIM protein, DKFZp686L0362, enigma homolog, PDZ and LIM domain 3, PDZ and LIM domain protein 3
Rabbit
39 kDa
100 μL
Primary
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot
0.5 mg/ml
Western Blot 1.0 ug/ml
Q53GG5
PDLIM3
Synthetic peptides corresponding to PDLIM3(PDZ and LIM domain 3) The peptide sequence was selected from the N terminal of PDLIM3. Peptide sequence PQTVILPGPAPWGFRLSGGIDFNQPLVITRITPGSKAAAANLCPGDVILA.
Affinity purified
RUO
27295
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Zebrafish
IgG
Product Suggestions

Product Suggestions

SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit