PDLIM3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155197

Catalog No. NBP155197

Description

PDLIM3 Polyclonal specifically detects PDLIM3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PDLIM3
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q53GG5
• Gene Symbols: PDLIM3
• Immunogen: Synthetic peptides corresponding to PDLIM3(PDZ and LIM domain 3) The peptide sequence was selected from the N terminal of PDLIM3. Peptide sequence PQTVILPGPAPWGFRLSGGIDFNQPLVITRITPGSKAAAANLCPGDVILA.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 27295
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Actinin-associated LIM protein, ALPFLJ26096, Alpha-actinin-2-associated LIM protein, DKFZp686L0362, enigma homolog, PDZ and LIM domain 3, PDZ and LIM domain protein 3
• Host Species: Rabbit
• Molecular Weight of Antigen: 39 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.